PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC03G14090.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family bZIP
Protein Properties Length: 169aa    MW: 18422.1 Da    PI: 9.2223
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC03G14090.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_1377.3e-122684563
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
           bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                     +   rk +NR++Ar+sR +K+++++ L+ ++++L  eN+a++  +    + +  +++e+
  OPUNC03G14090.1 26 RQRNRKKSNRLSARKSRMKKQQYVDGLAVEAEKLRRENDAMRAGVGAVLQRCRMVEQEN 84
                     3345788***********************************99888888887777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1709.6E-111978No hitNo description
SMARTSM003382.8E-122186IPR004827Basic-leucine zipper domain
PROSITE profilePS502179.9792487IPR004827Basic-leucine zipper domain
PfamPF001703.3E-82680IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.44E-82679No hitNo description
CDDcd147021.09E-142778No hitNo description
PROSITE patternPS0003603044IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 169 aa     Download sequence    Send to blast
MSVAPAPEGS ARRAAEATAT ATEEERQRNR KKSNRLSARK SRMKKQQYVD GLAVEAEKLR  60
RENDAMRAGV GAVLQRCRMV EQENRVLTAH ARELCSALQL RGSQLRLLGE VAGVPLDVPD  120
VADHLVQLYG GGGGGLGMPP LSPPRIPVLF FQPDSVMDAV SMIQDYESI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2268190.0AC226819.1 Oryza minuta clone OM__Ba0167K10, complete sequence.
GenBankAC2268210.0AC226821.1 Oryza minuta clone OM__Ba0192M11, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015631799.11e-76PREDICTED: ocs element-binding factor 1
TrEMBLA0A0E0KCR81e-120A0A0E0KCR8_ORYPU; Uncharacterized protein
STRINGORGLA03G0141100.11e-85(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125042837
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G75390.11e-12basic leucine-zipper 44